PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G18480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family TCP
Protein Properties Length: 282aa    MW: 29458.9 Da    PI: 7.4656
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G18480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP95.69.7e-3060137380
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaessss 80 
                      g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WL+++a+++i++l+ ++++++ +  a++  s
  LPERR05G18480.1  60 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLINAAQHEIDKLPPLQFPPHDDLLAAAAAS 137
                      78*************************************************************999997663333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-2661123IPR005333Transcription factor, TCP
PROSITE profilePS5136929.86661119IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MERHNNDLPK MMISGSTTTN DELAGAGGRK AESGISKAAS SRHWSASTES RIVRVSRVFG  60
GKDRHSKVRT VKGLRDRRVR LSVPTAIQLY DLQDRLGLSQ PSKVVDWLIN AAQHEIDKLP  120
PLQFPPHDDL LAAAAASMAM PPPPSSAMQL DDDDDKAAVG GGGVKGFMSL SNSLGLLNAT  180
TMPTSVTMAH HGGGGGAYYA AGGGESWGNG QAAAAAAVHN SPFPSLLSLA PGSQFVFYSP  240
EGGGFAMKEA AVEHFAVDNL DHSQGQLSLS SARSFLHSGS QG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126131e-113CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961521.11e-104PREDICTED: transcription factor TCP13-like isoform X1
RefseqXP_004961522.11e-104PREDICTED: transcription factor TCP13-like isoform X1
RefseqXP_012700333.11e-104PREDICTED: transcription factor TCP13-like isoform X1
TrEMBLA0A0D9WIK40.0A0A0D9WIK4_9ORYZ; Uncharacterized protein
STRINGORGLA05G0197200.11e-105(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.11e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5